PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C020871P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 186aa    MW: 21083.3 Da    PI: 8.482
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C020871P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF702.1e-221861649
                    HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    ks+rqvtfskRr+g++ KA ELS+L +ae+a+++fsstgk+y++
  MELO3C020871P1 18 KSRRQVTFSKRRAGLFNKAAELSILSGAEIAILVFSSTGKIYTF 61
                    89*****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.1E-29564IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.553565IPR002100Transcription factor, MADS-box
CDDcd002656.47E-33677No hitNo description
SuperFamilySSF554556.8E-25679IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-19727IPR002100Transcription factor, MADS-box
PfamPF003192.5E-211861IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-192742IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-194263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MKKSSGRQKI EIKKLNVKSR RQVTFSKRRA GLFNKAAELS ILSGAEIAIL VFSSTGKIYT  60
FGHPNVDMLI DRFLTSNFVP TKPAEAYLPL EELNRDLKDA TAEFEIEKMR AERMRNTGGF  120
WWDETEMECM GIEELKRFRS SLMELRGKVA EKVEELAAVN QEVLITSPSF HHHATTIEDL  180
GLGFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mnm_A7e-157701881PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
1mnm_B7e-157701881PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819130.0LN681913.1 Cucumis melo genomic scaffold, anchoredscaffold00045.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008457781.11e-135PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A0A0LLS21e-109A0A0A0LLS2_CUCSA; Mads box protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.18e-34AGAMOUS-like 62